PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C011410P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 73aa    MW: 8412.82 Da    PI: 10.7762
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C011410P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.65.8e-32959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+ienk+nrqvtf+kRrng+lKKA+ELS+LCdaeva+i+fs +gklye+ss
  MELO3C011410P1  9 KKIENKINRQVTFTKRRNGLLKKAYELSILCDAEVALIVFSARGKLYEFSS 59
                    78***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.193161IPR002100Transcription factor, MADS-box
CDDcd002651.52E-37261No hitNo description
SuperFamilySSF554551.07E-30265IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-33323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
MGRGRVELKK IENKINRQVT FTKRRNGLLK KAYELSILCD AEVALIVFSA RGKLYEFSSS  60
SRHVFNHFLS FY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D3e-20261160Myocyte-specific enhancer factor 2A
3mu6_C3e-20261160Myocyte-specific enhancer factor 2A
3mu6_B3e-20261160Myocyte-specific enhancer factor 2A
3mu6_A3e-20261160Myocyte-specific enhancer factor 2A
1tqe_S4e-20161161Myocyte-specific enhancer factor 2B
1tqe_R4e-20161161Myocyte-specific enhancer factor 2B
1tqe_Q4e-20161161Myocyte-specific enhancer factor 2B
1tqe_P4e-20161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818231e-119LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132571e-119LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445436.11e-35PREDICTED: truncated transcription factor CAULIFLOWER A
SwissprotQ396856e-34CMB1_DIACA; MADS-box protein CMB1
TrEMBLA0A103XKV51e-34A0A103XKV5_CYNCS; Transcription factor, K-box
TrEMBLA0A151RCR07e-35A0A151RCR0_CAJCA; Agamous-like MADS-box protein AGL9 isogeny
TrEMBLA0A151SPN87e-35A0A151SPN8_CAJCA; Agamous-like MADS-box protein AGL9 isogeny
STRINGPGSC0003DMT4000048757e-34(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.31e-34MIKC_MADS family protein